PDB entry 3dmn

View 3dmn on RCSB PDB site
Description: The crystal structure of the C-terminal domain of a possilbe DNA helicase from Lactobacillus plantarun WCFS1
Deposited on 2008-07-01, released 2008-08-26
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.193
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative DNA helicase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: lp_0910
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88Y78 (3-End)
      • expression tag (2)
  • Heterogens: ACT, EDO, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3dmnA (A:)
snasyrstqqitdftkeilvngeavtafdrqgdlpnvvvtpnfeagvdqvvdqlamndse
rdttaiigkslaecealtkalkargeqvtliqtenqrlapgvivvpsflakglefdaviv
wnanqenyqrederqllyticsramheltlvavgslspllarvnhalytlneak

    Sequence, based on observed residues (ATOM records):
    >3dmnA (A:)
asyrstqqitdftkeilvnrqgdlpnvvvtpnfeagvdqvvdqlamndserdttaiigks
laecealtkalkargeqvtliqtenrlapgvivvpsflakglefdavivwnanqenyqre
derqllyticsramheltlvavgslspllarvnhalytlne