PDB entry 3dml

View 3dml on RCSB PDB site
Description: crystal structure of the periplasmic thioredoxin soxs from paracoccus pantotrophus (reduced form)
Deposited on 2008-07-01, released 2008-08-26
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3dmlA (A:)
    mrgshhhhhhgsddddkaelrllmfeqpgclycarwdaeiapqypltdegraapvqrlqm
    rdplppglelarpvtftptfvlmagdvesgrlegypgedffwpmlarligqaepgq
    

    Sequence, based on observed residues (ATOM records):
    >3dmlA (A:)
    elrllmfeqpgclycarwdaeiapqypltdegraapvqrlqmrdplppglelarpvtftp
    tfvlmagdvesgrlegypgedffwpmlarligqaep