PDB entry 3dmi

View 3dmi on RCSB PDB site
Description: Crystallization and Structural Analysis of Cytochrome c6 from the Diatom Phaeodactylum tricornutum at 1.5 A resolution
Class: electron transport
Keywords: ELECTRON TRANSPORT, Cytochrome c6, Phaeodactylum tricornutum, Transit peptide
Deposited on 2008-07-01, released 2009-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c6
  Species: Phaeodactylum tricornutum [TaxId:2850]
  Gene: pet J
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8GTB5 (0-End)
  Domains in SCOPe 2.08: d3dmia_
• Heterogens: MG, HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3dmiA (A:)
  gdvgageqifnancaachaggqnvimpektlekealdqylaggrteksiisqvtggknam
  pafggrlsdeeianvaayvlasaeagwe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3dmiA (A:)
  gdvgageqifnancaachaggqnvimpektlekealdqylaggrteksiisqvtggknam
  pafggrlsdeeianvaayvlasaeagw