PDB entry 3dlq

View 3dlq on RCSB PDB site
Description: Crystal structure of the IL-22/IL-22R1 complex
Class: cytokine/cytokine receptor
Keywords: cytokine-receptor complex, fibronectin-III, Cytokine, Glycoprotein, Polymorphism, Secreted, Membrane, Receptor, Transmembrane, CYTOKINE-CYTOKINE RECEPTOR COMPLEX
Deposited on 2008-06-28, released 2008-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: Interleukin-22
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GZX6 (Start-150)
      • engineered (11)
    Domains in SCOPe 2.07: d3dlqi_
  • Chain 'R':
    Compound: Interleukin-22 receptor subunit alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22RA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N6P7 (Start-210)
      • engineered (186)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3dlqI (I:)
    qggaaapissharldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmser
    cylmkqvlnftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqkl
    kdtvkklgesgeikaigeldllfmslrnaci
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dlqI (I:)
    arldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnft
    leevlfpqsdrfqpymqevvpflarlsnrlshiqrnvqklkdtvkklgesgeikaigeld
    llfmslrnaci
    

  • Chain 'R':
    No sequence available.