PDB entry 3dlc

View 3dlc on RCSB PDB site
Description: crystal structure of a putative s-adenosyl-l-methionine-dependent methyltransferase (mmp1179) from methanococcus maripaludis at 1.15 a resolution
Deposited on 2008-06-27, released 2008-08-26
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative S-adenosyl-L-methionine-dependent Methyltransferase
    Species: Methanococcus maripaludis [TaxId:39152]
    Gene: NP_988299.1, MMP1179
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6LY14 (1-218)
      • leader sequence (0)
      • see remark 999 (45)
      • see remark 999 (89)
      • see remark 999 (127)
      • see remark 999 (194)
      • see remark 999 (202)
  • Heterogens: ACT, SAM, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3dlcA (A:)
gmsenkkkfdkkgaknmdeisktlfapiypiiaeniinrfgitagtcidigsgpgalsia
lakqsdfsiraldfskhmneialkniadanlndriqivqgdvhnipiednyadlivsrgs
vffwedvatafreiyrilksggktyigggfgnkelrdsisaemirknpdwkefnrknisq
enverfqnvldeigissyeiilgdegfwiiisktdqevi