PDB entry 3dko

View 3dko on RCSB PDB site
Description: Complex between the kinase domain of human ephrin type-a receptor 7 (epha7) and inhibitor alw-ii-49-7
Class: transferase
Keywords: ATP-BINDING, KINASE, NUCLEOTIDE-BINDING, RECEPTOR, SIGNAL, TRANSFERASE, PHOSPHORYLATION, TRANSMEMBRANE, TYROSINE-PROTEIN KINASE, ALTERNATIVE SPLICING, GLYCOPROTEIN, INHIBITOR, STRUCTURAL GENOMICS CONSORTIUM, SGC, Membrane, Phosphoprotein, Polymorphism, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2008-06-25, released 2008-08-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 7
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7, EHK3, HEK11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15375 (Start-310)
      • expression tag (311-313)
    Domains in SCOPe 2.05: d3dkoa_
  • Heterogens: IHZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dkoA (A:)
    mqegdeelyfhfkfpgtktyidpetyedpnravhqfakeldascikiervigagefgevc
    sgrlklpgkrdvavaiktlkvgytekqrrdflceasimgqfdhpnvvhlegvvtrgkpvm
    iviefmengaldaflrkhdgqftviqlvgmlrgiaagmryladmgyvhrdlaarnilvns
    nlvckvsdfglsrvieddpeavytttggkipvrwtapeaiqyrkftsasdvwsygivmwe
    vmsygerpywdmsnqdvikaieegyrlpapmdcpaglhqlmldcwqkeraerpkfeqivg
    ildkmirnpnsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dkoA (A:)
    tyidpetyedpnravhqfakeldascikiervigaefgevcsgrlklpgkrdvavaiktl
    kvgytekqrrdflceasimgqfdhpnvvhlegvvtrgkpvmiviefmengaldaflrkhd
    gqftviqlvgmlrgiaagmryladmgyvhrdlaarnilvnsnlvckvsdfgpvrwtapea
    iqyrkftsasdvwsygivmwevmsygerpywdmsnqdvikaieegyrlpapmdcpaglhq
    lmldcwqkeraerpkfeqivgildkmirnpnsahh