PDB entry 3dkn

View 3dkn on RCSB PDB site
Description: Sec61 in the Canine ribosome-channel complex from the endoplasmic reticulum
Class: protein transport/RNA
Keywords: Ribosome-channel complex, co-translational translocation, endoplasmic reticulum, protein transport-RNA COMPLEX
Deposited on 2008-06-25, released 2008-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: 8.7 Å
R-factor: N/A
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Preprotein translocase subunit secY
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DKN (0-429)
  • Chain 'B':
    Compound: Preprotein translocase subunit secE
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DKN (0-64)
    Domains in SCOPe 2.08: d3dknb1
  • Chain 'C':
    Compound: Preprotein translocase subunit secG
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DKN (0-31)
    Domains in SCOPe 2.08: d3dknc1
  • Chain 'D':
    Compound: RNA (5'-r(p*cp*gp*up*gp*cp*cp*ap*ap*gp*cp*up*gp*cp*gp*ap*up*ap*ap*gp*c)-3')
    Species: Canis lupus familiaris [TaxId:9615]
  • Chain 'E':
    Compound: RNA (5'-r(p*ap*gp*cp*cp*gp*cp*ap*cp*gp*gp*ap*gp*gp*cp*gp*ap*a)-3')
    Species: Canis lupus familiaris [TaxId:9615]
  • Chain 'F':
    Compound: RNA (32-mer)
    Species: Canis lupus familiaris [TaxId:9615]

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dknB (B:)
    tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
    kgilk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dknC (C:)
    etfskirvkpehvigvtvafviieailtygrf
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.