PDB entry 3dkf

View 3dkf on RCSB PDB site
Description: Structure of MET receptor tyrosine kinase in complex with inhibitor SGX-523
Class: oncoprotein
Keywords: DRUG DISCOVERY, c-MET KINASE, FRAGMENT BASED, Membrane, Receptor, Transmembrane, ONCOPROTEIN
Deposited on 2008-06-24, released 2009-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET, hCG_38705, tcag7.66
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-314)
      • engineered mutation (148)
      • expression tag (315)
    Domains in SCOPe 2.06: d3dkfa1, d3dkfa2
  • Heterogens: CL, SX8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dkfA (A:)
    gslntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkki
    hcavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdl
    rnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgl
    ardmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappyp
    dvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi
    gehyvhvnatyvnvkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dkfA (A:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlkkihcavkslnr
    itdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirneth
    nptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmyklpv
    kwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpey
    cpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvke