PDB entry 3dk5

View 3dk5 on RCSB PDB site
Description: Crystal Structure of Apo-GlmU from Mycobacterium tuberculosis
Class: transferase
Keywords: ACETYLTRANSFERASE, BIFUNCTIONAL, PYROPHOSPHORYLASE, ROSSMANN-LIKE FOLD, LEFT-HANDED-BETA-HELIX, TRIMER, Cell shape, Cell wall biogenesis/degradation, Cytoplasm, Magnesium, Metal-binding, Multifunctional enzyme, Nucleotidyltransferase, Peptidoglycan synthesis, Transferase
Deposited on 2008-06-24, released 2009-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: glmU, MRA_1026
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dk5a1, d3dk5a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dk5A (A:)
    mtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdh
    qriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtpllda
    dtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirev
    nagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnn
    rvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqigg
    rcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafve
    vknstigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrtgsdtmf
    vapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqaskrasem
    acqqptqppdadqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dk5A (A:)
    dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
    lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
    liathravsaavtvltttlddpfygrivmaivevnagvyafdiaalrsalsrlssnnqqe
    lyltdviailrsdgqtvhashvddsalvagvnnrvqlaelaselnrrvvaahqlagvtvv
    dpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvrthgs
    sssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadigeys
    nigassvfvnkrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvppgalavsag
    pqrnienwvqrkrpgspaaqas