PDB entry 3dk1

View 3dk1 on RCSB PDB site
Description: Wild Type HIV-1 Protease with potent Antiviral inhibitor GRL-0105A
Class: hydrolase
Keywords: HIV-1, wild type protease, protease inhibitor, HYDROLASE, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, Cytoplasm, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Lipoprotein, Magnesium, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, Ribosomal frameshifting, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc, Zinc-finger
Deposited on 2008-06-24, released 2009-05-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.152
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.04: d3dk1a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.04: d3dk1b_
  • Heterogens: NA, CL, G05, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dk1A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dk1B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf