PDB entry 3dk0

View 3dk0 on RCSB PDB site
Description: Crystal structure of transthyretin variant L55P at acidic pH
Class: transport protein
Keywords: TTR, AMYLOID FIBRILS, POINT MUTATION, TRANSPORT PROTEIN, Amyloid, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hormone, Polyneuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A
Deposited on 2008-06-24, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d3dk0a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d3dk0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dk0A (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dk0A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dk0B (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dk0B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp