PDB entry 3djv

View 3djv on RCSB PDB site
Description: Bovine Seminal Ribonuclease- cytidine 3' phosphate complex
Class: hydrolase
Keywords: Ribonuclease, HYDROLASE, Allosteric enzyme, Endonuclease, Nuclease, Secreted
Deposited on 2008-06-24, released 2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3djva_
  • Chain 'B':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3djvb_
  • Heterogens: C3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3djvA (A:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3djvB (B:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv