PDB entry 3djn

View 3djn on RCSB PDB site
Description: Crystal structure of mouse TIS21
Class: transcription
Keywords: beta-alpha-barrels, Transcription, Transcription regulation
Deposited on 2008-06-24, released 2008-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Protein BTG2
  Species: Mus musculus [TaxId:10090]
  Gene: Tis21
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04211 (0-117)
  Domains in SCOPe 2.08: d3djnb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3djnB (B:)
  dmlpeiaaavgflssllrtrgcvseqrlkvfsralqdaltdhykhhwfpekpskgsgyrc
  irinhkmdpiiskvasqiglsqpqlhrllpseltlwvdpyevsyrigedgsicvlyee