PDB entry 3djk

View 3djk on RCSB PDB site
Description: Wild Type HIV-1 Protease with potent Antiviral inhibitor GRL-0255A
Class: hydrolase
Keywords: HIV-1, wild type protease, protease inhibitor, HYDROLASE, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, Cytoplasm, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Lipoprotein, Magnesium, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, Ribosomal frameshifting, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc, Zinc-finger
Deposited on 2008-06-23, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.08: d3djka_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.08: d3djkb_
  • Heterogens: NA, CL, G55, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3djkA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3djkB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf