PDB entry 3djb

View 3djb on RCSB PDB site
Description: Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114
Class: hydrolase
Keywords: all alpha-helical protein., Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Hydrolase
Deposited on 2008-06-23, released 2008-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.246
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, HD family
    Species: Bacillus thuringiensis serovar konkukian [TaxId:180856]
    Gene: BT9727_1981
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6HJG6
      • engineered (30)
      • engineered (35)
      • engineered (116)
    Domains in SCOPe 2.07: d3djba1
  • Chain 'B':
    Compound: Hydrolase, HD family
    Species: Bacillus thuringiensis serovar konkukian [TaxId:180856]
    Gene: BT9727_1981
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6HJG6
      • engineered (30)
      • engineered (35)
      • engineered (116)
    Domains in SCOPe 2.07: d3djbb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3djbA (A:)
    mtkqekiektitfvkhilekdasghdwyhirrvhkmaislseqeggnrfiiemaallhdv
    adeklneseeagmkkvsdwleelhveeeeskhvlhiianmsykgghggkvesiegklvqd
    adrldalgaigiartfayggakgrlmydptipprevmtkdeyrknndpslnhfyekllkl
    kdlmntnaakqeaevrhrymeqfieqfmkewnaqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3djbA (A:)
    tkqekiektitfvkhilekdasghdwyhirrvhkmaislseqeggnrfiiemaallhdva
    dlneseeagmkkvsdwleelhveeeeskhvlhiianmsiegklvqdadrldalgaigiar
    tfayggakgrlmydptipprdpslnhfyekllklkdlmntnaakqeaevrhrymeqfieq
    fmkewnaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3djbB (B:)
    mtkqekiektitfvkhilekdasghdwyhirrvhkmaislseqeggnrfiiemaallhdv
    adeklneseeagmkkvsdwleelhveeeeskhvlhiianmsykgghggkvesiegklvqd
    adrldalgaigiartfayggakgrlmydptipprevmtkdeyrknndpslnhfyekllkl
    kdlmntnaakqeaevrhrymeqfieqfmkewnaqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3djbB (B:)
    tkqekiektitfvkhilekdasghdwyhirrvhkmaislseqeggnrfiiemaallhdva
    dlneseeagmkkvsdwleelhveeeeskhvlhiianmsiegklvqdadrldalgaigiar
    tfayggakgrlmydptipprdpslnhfyekllklkdlmntnaakqeaevrhrymeqfieq
    fmkewnaq