PDB entry 3dj6

View 3dj6 on RCSB PDB site
Description: Crystal structure of the mouse Aurora-A catalytic domain (Asn186->Gly, Lys240->Arg, Met302->Leu) in complex with Compound 823.
Class: transferase
Keywords: Aurora A, small-molecule inhibitor, fragment-based drug discovery, Kinase, Transferase
Deposited on 2008-06-22, released 2009-05-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.217
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine kinase 6
    Species: Mus musculus [TaxId:10090]
    Gene: Aurka, Stk6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C3H8
      • engineered (53)
      • engineered (107)
      • engineered (169)
    Domains in SCOPe 2.04: d3dj6a_
  • Heterogens: AK6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dj6A (A:)
    gplgskrqwtledfdigrplgkgkfgnvylarerqskfilalkvlfktqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklsrfdeqrtatyite
    lanalsychskrvihrdikpenlllgsngelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgmppfeahtyqetyrrisrveftfpdfvtegardl
    isrllkhnasqrltlaevlehpwikansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dj6A (A:)
    wtledfdigrplgkgkfgnvylarerqskfilalkvlfktqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdatrvylileyaplgtvyrelqklsrfdeqrtatyitelanalsyc
    hskrvihrdikpenlllgsngelkiadfgwttlcgtldylppemiegrmhdekvdlwslg
    vlcyeflvgmppfeahtyqetyrrisrveftfpdfvtegardlisrllkhnasqrltlae
    vlehpwikanss