PDB entry 3dj4

View 3dj4 on RCSB PDB site
Description: Crystal Structure of GlmU from Mycobacterium tuberculosis in complex with URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE.
Class: transferase
Keywords: ACETYLTRANSFERASE, BIFUNCTIONAL, PYROPHOSPHORYLASE, ROSSMANN-LIKE FOLD, LEFT-HANDED-BETA-HELIX, TRIMER, Cell shape, Cell wall biogenesis/degradation, Cytoplasm, Magnesium, Metal-binding, Multifunctional enzyme, Nucleotidyltransferase, Peptidoglycan synthesis, Transferase, Acyltransferase
Deposited on 2008-06-22, released 2009-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.197
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glmU, Rv1018c, MT1046
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dj4a1, d3dj4a2
  • Heterogens: MG, CO, UD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dj4A (A:)
    mtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdh
    qriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtpllda
    dtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirev
    nagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnn
    rvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqigg
    rcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafve
    vknstigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrtgsdtmf
    vapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqaskrasem
    acqqptqppdadqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dj4A (A:)
    dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
    lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
    liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
    afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
    elaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvg
    pdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafvevknst
    igtgtkvphltyvgdadigeysnigassvfvnrttvgshvrtgsdtmfvapvtigdgayt
    gagtvvredvppgalavsagpqrnienwvqrkrpgspaaqas