PDB entry 3din

View 3din on RCSB PDB site
Description: Crystal structure of the protein-translocation complex formed by the SecY channel and the SecA ATPase
Class: membrane protein, protein transport
Keywords: protein translocation, membrane protein, ATPase, ATP-binding, Inner membrane, Nucleotide-binding, Protein transport, Transport, Transmembrane
Deposited on 2008-06-20, released 2008-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 4.5 Å
R-factor: 0.279
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein translocase subunit secA
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: secA, TM_1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dina1, d3dina2, d3dina3, d3dina4
  • Chain 'B':
    Compound: Protein translocase subunit secA
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: secA, TM_1578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dinb1, d3dinb2, d3dinb3, d3dinb4
  • Chain 'C':
    Compound: Preprotein translocase subunit secY
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: secY, TM_1480
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dinc_
  • Chain 'D':
    Compound: Preprotein translocase subunit secE
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: secE, TM_0452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dind_
  • Chain 'E':
    Compound: Preprotein translocase subunit secG
    Species: Thermotoga sp. [TaxId:126740]
    Gene: secG, TRQ2_0456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dine_
  • Chain 'F':
    Compound: Preprotein translocase subunit secY
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: secY, TM_1480
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dinf_
  • Chain 'G':
    Compound: Preprotein translocase subunit secE
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: secE, TM_0452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ding_
  • Chain 'H':
    Compound: Preprotein translocase subunit secG
    Species: Thermotoga sp. [TaxId:126740]
    Gene: secG, TRQ2_0456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dinh_
  • Heterogens: MG, ADP, BEF

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dinA (A:)
    milfdknkrilkkyakmvskinqiesdlrskknselirlsmvlkekvnsfedadehlfea
    falvreaarrtlgmrpfdvqvmggialhegkvaemktgegktlaatmpiylnaligkgvh
    lvtvndylarrdalwmgpvylflglrvgvinslgksyevvwknpdlarkaieenwsvwpd
    gfngevlkeesmnkeaveafqvelkeitrkeaylcdvtygtnnefgfdylrdnlvldynd
    kvqrghfyaivdeadsvlideartpliisgpskespsvyrrfaqiakkfvkdkdftvdek
    artiilteegvakaekiigvenlydpgnvsllyhlinalkalhlfkkdvdyvvmngevii
    vdeftgrllpgrrysgglhqaieakegvpikeesityatitfqnyfrmyeklagmtgtak
    teesefvqvygmevvvipthkpmirkdhddlvfrtqkekyekiveeiekrykkgqpvlvg
    ttsieksellssmlkkkgiphqvlnakyhekeaeivakagqkgmvtiatnmagrgtdikl
    gpgvaelgglciigterhesrridnqlrgragrqgdpgesifflsleddllrifgseqig
    kvmnilkieegqpiqhpmlsklieniqkkveginfsirktlmemddvldkqrravyslrd
    qillekdydeylkdifedvvstrveefcsgknwdieslknslsffpaglfdldekqfsss
    eelhdylfnrlweeyqrkkqeigedyrkvirflmlriiddhwrryleevehvkeavqlrs
    ygqkdpivefkketyymfdemmrrindtianyvlrvvkvsekdekeakeelgkirlvhee
    fnlvnramrratekkkkkdglhsfgrirvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dinA (A:)
    milfdknkrilkkyakmvskinqiesdlrskknselirlsmvlkekvnsfedadehlfea
    falvreaarrtlgmrpfdvqvmggialhegkvaemktgegktlaatmpiylnaligkgvh
    lvtvndylarrdalwmgpvylflglrvgvinslgksyevvwknpdlarkaieenwsvwpd
    gfngevlkeesmnkeaveafqvelkeitrkeaylcdvtygtnnefgfdylrdnlvldynd
    kvqrghfyaivdeadsvlideartpliisgpskespsvyrrfaqiakkfvkdkdftvdek
    artiilteegvakaekiigvenlydpgnvsllyhlinalkalhlfkkdvdyvvmngevii
    vdeftgrllpgrrysgglhqaieakegvpikeesityatitfqnyfrmyeklagmtgtak
    teesefvqvygmevvvipthkpmirkdhddlvfrtqkekyekiveeiekrykkgqpvlvg
    ttsieksellssmlkkkgiphqvlnakyhekeaeivakagqkgmvtiatnmagrgtdikl
    gpgvaelgglciigterhesrridnqlrgragrqgdpgesifflsleddllrifgseqig
    kvmnilkieegqpiqhpmlsklieniqkkveginfsirktlmemddvldkqrravyslrd
    qillekdydeylkdifedvvstrveefcsgknwdieslknslsffpaglfdldekqfsss
    eelhdylfnrlweeyqrkkqeigedyrkvirflmlriiddhwrryleevehvkeavqlrs
    ygqkdpivefkketyymfdemmrrindtianyvlrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dinB (B:)
    milfdknkrilkkyakmvskinqiesdlrskknselirlsmvlkekvnsfedadehlfea
    falvreaarrtlgmrpfdvqvmggialhegkvaemktgegktlaatmpiylnaligkgvh
    lvtvndylarrdalwmgpvylflglrvgvinslgksyevvwknpdlarkaieenwsvwpd
    gfngevlkeesmnkeaveafqvelkeitrkeaylcdvtygtnnefgfdylrdnlvldynd
    kvqrghfyaivdeadsvlideartpliisgpskespsvyrrfaqiakkfvkdkdftvdek
    artiilteegvakaekiigvenlydpgnvsllyhlinalkalhlfkkdvdyvvmngevii
    vdeftgrllpgrrysgglhqaieakegvpikeesityatitfqnyfrmyeklagmtgtak
    teesefvqvygmevvvipthkpmirkdhddlvfrtqkekyekiveeiekrykkgqpvlvg
    ttsieksellssmlkkkgiphqvlnakyhekeaeivakagqkgmvtiatnmagrgtdikl
    gpgvaelgglciigterhesrridnqlrgragrqgdpgesifflsleddllrifgseqig
    kvmnilkieegqpiqhpmlsklieniqkkveginfsirktlmemddvldkqrravyslrd
    qillekdydeylkdifedvvstrveefcsgknwdieslknslsffpaglfdldekqfsss
    eelhdylfnrlweeyqrkkqeigedyrkvirflmlriiddhwrryleevehvkeavqlrs
    ygqkdpivefkketyymfdemmrrindtianyvlrvvkvsekdekeakeelgkirlvhee
    fnlvnramrratekkkkkdglhsfgrirvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dinB (B:)
    milfdknkrilkkyakmvskinqiesdlrskknselirlsmvlkekvnsfedadehlfea
    falvreaarrtlgmrpfdvqvmggialhegkvaemktgegktlaatmpiylnaligkgvh
    lvtvndylarrdalwmgpvylflglrvgvinslgksyevvwknpdlarkaieenwsvwpd
    gfngevlkeesmnkeaveafqvelkeitrkeaylcdvtygtnnefgfdylrdnlvldynd
    kvqrghfyaivdeadsvlideartpliisgpskespsvyrrfaqiakkfvkdkdftvdek
    artiilteegvakaekiigvenlydpgnvsllyhlinalkalhlfkkdvdyvvmngevii
    vdeftgrllpgrrysgglhqaieakegvpikeesityatitfqnyfrmyeklagmtgtak
    teesefvqvygmevvvipthkpmirkdhddlvfrtqkekyekiveeiekrykkgqpvlvg
    ttsieksellssmlkkkgiphqvlnakyhekeaeivakagqkgmvtiatnmagrgtdikl
    gpgvaelgglciigterhesrridnqlrgragrqgdpgesifflsleddllrifgseqig
    kvmnilkieegqpiqhpmlsklieniqkkveginfsirktlmemddvldkqrravyslrd
    qillekdydeylkdifedvvstrveefcsgknwdieslknslsffpaglfdldekqfsss
    eelhdylfnrlweeyqrkkqeigedyrkvirflmlriiddhwrryleevehvkeavqlrs
    ygqkdpivefkketyymfdemmrrindtianyvlrv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dinC (C:)
    mwqafknafkipelrdriiftflalivfrmgiyipvpglnleawgeifrriaetagvagi
    lsfydvftggalsrfsvftmsvtpyitasiilqllasvmpslkemlregeegrkkfakyt
    rrltlliggfqaffvsfslarsnpdmvapgvnvlqftvlstmsmlagtmfllwlgerite
    kgigngisilifagivarypsyirqaylgglnllewifliavalitifgiilvqqaerri
    tiqyarrvtgrrvyggastylpikvnqggvipiifasaivsipsaiasitnnetlknlfr
    aggflylliygllvffftyfysvvifdpreisenirkyggyipglrpgrsteqylhrvln
    rvtfigavflvviallpylvqgaikvnvwiggtsaliavgvaldiiqqmethmvmrhyeg
    fikkgkirgrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dinC (C:)
    afkipelrdriiftflalivfrmgiyipvpglnlsfydvftggalsrfsvftmsvtpyit
    asiilqllasvmpslkemlregeegrkkfakytrrltlliggfqaffvsfslarsnpdmv
    apgvnvlqftvlstmsmlagtmfllwlgeritekgigngisilifagivarypsyirqay
    lgglnllewifliavalitifgiilvqqaerritiqyarrvtgrrvyggastylpikvnq
    ggvipiifasaivsipsaiasitnnetlknlfraggflylliygllvffftyfysvvifd
    preisenirkyggyipglrpgrsteqylhrvlnrvtfigavflvviallpylvqgaikvn
    vwiggtsaliavgvaldiiqqmethmvmrhyegfik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dinD (D:)
    meklrkffreviaeakkiswpsrkelltsfgvvlvilavtsvyffvldfifsgvvsaifk
    algig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dinD (D:)
    eviaeakkiswpsrkelltsfgvvlvilavtsvyffvldfifsgvvsaifkalgig
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3dinE (E:)
    mktfflivhtiisvaliymvqvqmskfselggafgsgglhtvfgrrkgldtggkitlvls
    vlffvscvvtafvltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dinE (E:)
    htiisvaliymvqvqmskfselggafgsgglhtvfgrrkgldtggkitlvlsvlffvscv
    vtafv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3dinF (F:)
    mwqafknafkipelrdriiftflalivfrmgiyipvpglnleawgeifrriaetagvagi
    lsfydvftggalsrfsvftmsvtpyitasiilqllasvmpslkemlregeegrkkfakyt
    rrltlliggfqaffvsfslarsnpdmvapgvnvlqftvlstmsmlagtmfllwlgerite
    kgigngisilifagivarypsyirqaylgglnllewifliavalitifgiilvqqaerri
    tiqyarrvtgrrvyggastylpikvnqggvipiifasaivsipsaiasitnnetlknlfr
    aggflylliygllvffftyfysvvifdpreisenirkyggyipglrpgrsteqylhrvln
    rvtfigavflvviallpylvqgaikvnvwiggtsaliavgvaldiiqqmethmvmrhyeg
    fikkgkirgrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dinF (F:)
    afkipelrdriiftflalivfrmgiyipvpglnlsfydvftggalsrfsvftmsvtpyit
    asiilqllasvmpslkemlregeegrkkfakytrrltlliggfqaffvsfslarsnpdmv
    apgvnvlqftvlstmsmlagtmfllwlgeritekgigngisilifagivarypsyirqay
    lgglnllewifliavalitifgiilvqqaerritiqyarrvtgrrvyggastylpikvnq
    ggvipiifasaivsipsaiasitnnetlknlfraggflylliygllvffftyfysvvifd
    preisenirkyggyipglrpgrsteqylhrvlnrvtfigavflvviallpylvqgaikvn
    vwiggtsaliavgvaldiiqqmethmvmrhyegfik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3dinG (G:)
    meklrkffreviaeakkiswpsrkelltsfgvvlvilavtsvyffvldfifsgvvsaifk
    algig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dinG (G:)
    eviaeakkiswpsrkelltsfgvvlvilavtsvyffvldfifsgvvsaifkalgig
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3dinH (H:)
    mktfflivhtiisvaliymvqvqmskfselggafgsgglhtvfgrrkgldtggkitlvls
    vlffvscvvtafvltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dinH (H:)
    htiisvaliymvqvqmskfselggafgsgglhtvfgrrkgldtggkitlvlsvlffvscv
    vtafv