PDB entry 3dih

View 3dih on RCSB PDB site
Description: Crystal structure of ammodytin L
Class: Toxin
Keywords: phospholipase A2 fold, Myotoxin, Secreted, Toxin
Deposited on 2008-06-20, released 2008-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.156
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog, ammodytin L
    Species: Vipera ammodytes ammodytes [TaxId:8705]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3diha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dihA (A:)
    sviefgkmiqeetdknpltsysfygchcglgnkgkpkdatdrccfvhsccyaklsdcspk
    tnryeyhrengaivcgsstpckkqicecdraaaicfrenlktynkkykvylrfkckgvse
    kc