PDB entry 3dif

View 3dif on RCSB PDB site
Description: Crystal structure of FabOX117
Class: immune system
Keywords: Antibody fragments, Fabs, Transient expression, Structural Genomics, Oxford Protein Production Facility, OPPF, Immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2008-06-20, released 2008-08-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FabOX117 Light Chain Fragment
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3DIF (0-End)
  • Chain 'B':
    Compound: FabOX117 Heavy Chain Fragment
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3DIF (0-End)
    Domains in SCOPe 2.02: d3difb1
  • Chain 'C':
    Compound: FabOX117 Light Chain Fragment
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3DIF (0-213)
  • Chain 'D':
    Compound: FabOX117 Heavy Chain Fragment
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3DIF (0-End)
    Domains in SCOPe 2.02: d3difd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3difB (B:)
    evklqqsgpelvkpgasvkisckasgysftsyyihwvkqrpgqglewigwvfpgsgntky
    nekfkgkatltadtssstaymqlssltsedsavyfcargnydrawfaywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3difB (B:)
    evklqqsgpelvkpgasvkisckasgysftsyyihwvkqrpgqglewigwvfpgsgntky
    nekfkgkatltadtssstaymqlssltsedsavyfcargnydrawfaywgqgtlvtvsaa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3difD (D:)
    evklqqsgpelvkpgasvkisckasgysftsyyihwvkqrpgqglewigwvfpgsgntky
    nekfkgkatltadtssstaymqlssltsedsavyfcargnydrawfaywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3difD (D:)
    evklqqsgpelvkpgasvkisckasgysftsyyihwvkqrpgqglewigwvfpgsgntky
    nekfkgkatltadtssstaymqlssltsedsavyfcargnydrawfaywgqgtlvtvsaa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsetvtcnvahpasstkvdkkivprd