PDB entry 3dhp

View 3dhp on RCSB PDB site
Description: Probing the role of aromatic residues at the secondary saccharide binding sites of human salivary alpha-amylase in substrate hydrolysis and bacterial binding
Class: hydrolase
Keywords: amylase acarbose aromatic residues mutagenesis, Calcium, Carbohydrate metabolism, Chloride, Glycoprotein, Glycosidase, Hydrolase, Metal-binding, Pyrrolidone carboxylic acid, Secreted
Deposited on 2008-06-18, released 2008-07-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.17
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04745 (0-495)
      • see remark 999 (0)
      • engineered (133)
      • engineered (202)
      • engineered (275)
      • engineered (283)
      • engineered (315)
      • engineered (387)
    Domains in SCOPe 2.04: d3dhpa1, d3dhpa2
  • Heterogens: GLC, CA, CL, HMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dhpA (A:)
    eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgadfndgkcktgsgdienyndatqvrdcrlsglldlalgkdyvrskia
    eymnhlidigvagfridaskhmapgdikaildklhnlnsnwfpegskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsalknwgegagfmpsdralvfvdnhd
    nqrghgaggasiltfadarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp
    pndngvtkevtinpdttcgndwvcehrarqirnmvnfrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl