PDB entry 3dha

View 3dha on RCSB PDB site
Description: an ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site
Deposited on 2008-06-17, released 2008-07-29
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acyl homoserine lactone hydrolase
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Gene: aiia
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7B8B9 (4-253)
      • expression tag (0-3)
  • Heterogens: ZN, C6L, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3dhaA (A:)
grismtvkklyfipagrcmldhssvnsaltpgkllnlpvwcylleteegpilvdtgmpes
avnneglfngtfvegqilpkmteedrivnilkrvgyepddllyiisshlhfdhaggngaf
tntpiivqrteyeaalhreeymkecilphlnykiiegdyevvpgvqllytpghspghqsl
fieteqsgsvlltidasytkenfedevpfagfdpelalssikrlkevvkkekpiiffghd
ieqekscrvfpeyi