PDB entry 3dh6

View 3dh6 on RCSB PDB site
Description: Crystal structure of bovine pancreatic ribonuclease A variant (V47A)
Class: hydrolase
Keywords: ribonuclease, RNase A, hydrolase, Bovine pancreas, Endonuclease, Glycation, Glycoprotein, Nuclease, Secreted
Deposited on 2008-06-17, released 2008-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1, RNS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • engineered (46)
    Domains in SCOPe 2.08: d3dh6a_
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dh6A (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfahesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv