PDB entry 3dgy

View 3dgy on RCSB PDB site
Description: Crystal structure of ribonuclease Sa2 with guanosine-2'-cyclophosphate
Class: Hydrolase
Keywords: ribonuclease, hydrolase, protein-mononucleotide complex, guanosine-2'-monophosphate, mononucleotide
Deposited on 2008-06-16, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dgya_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dgyb_
  • Chain 'C':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dgyc_
  • Heterogens: BGC, SO4, 2GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dgyA (A:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgyA (A:)
    aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
    drgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dgyB (B:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgyB (B:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpdrgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dgyC (C:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgyC (C:)
    ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpgs
    rgtrrvvtggygeqywspdhyatfqeidprc