PDB entry 3dgl

View 3dgl on RCSB PDB site
Description: 1.8 a crystal structure of a non-biological protein with bound atp in a novel bent conformation
Deposited on 2008-06-13, released 2009-06-30
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP Binding Protein-DX
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DGL
  • Heterogens: ZN, ATP, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3dglA (A:)
gsmdykddddkktnwlkriyrvrpcvkckvaprdwkvknkhlriynmcktcfnnsidigd
dtyhghvdwlmyadskeisnt

    Sequence, based on observed residues (ATOM records):
    >3dglA (A:)
ddddkktnwlkriyrvrpcvkckvaprdwkvknkhlriynmcktcfnnsidigddtyhgh
vdwlmyads