PDB entry 3dgk

View 3dgk on RCSB PDB site
Description: Crystal structure of a glycine-rich loop mutant of the death associated protein kinase catalytic domain
Class: transferase
Keywords: Kinase domain, glycine-rich loop mutation, ANK repeat, Apoptosis, ATP-binding, Calmodulin-binding, Cytoplasm, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2008-06-13, released 2009-05-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK1, DAPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53355
      • engineered (22)
      • conflict (291-292)
    Domains in SCOPe 2.05: d3dgka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dgkA (A:)
    mtvfrqenvddyydtgeelgsgkfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgkA (A:)
    tvfrqenvddyydtgeelgsgkfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikpqf