PDB entry 3dgd

View 3dgd on RCSB PDB site
Description: Crystal structure of the F87M/L110M mutant of human transthyretin at pH 4.6
Class: ligand binding protein
Keywords: transthyretin, monomer, amyloidogenic intermediate, acidic ph, thyroid hormone binding protein, ligand binding protein
Deposited on 2008-06-13, released 2008-07-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.159
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PLAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (86)
      • engineered (109)
    Domains in SCOPe 2.03: d3dgda_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PLAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (86)
      • engineered (109)
    Domains in SCOPe 2.03: d3dgdb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PLAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (86)
      • engineered (109)
    Domains in SCOPe 2.03: d3dgdc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PLAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (86)
      • engineered (109)
    Domains in SCOPe 2.03: d3dgdd_
  • Heterogens: ZN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dgdA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgdA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dgdB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgdB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dgdC (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgdC (C:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dgdD (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgdD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn