PDB entry 3dfy

View 3dfy on RCSB PDB site
Description: Crystal structure of apo dipeptide epimerase from Thermotoga maritima
Class: isomerase
Keywords: dipeptide epimerase, Thermotoga maritima, enzymatic function, Isomerase
Deposited on 2008-06-12, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.246
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfya1, d3dfya2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyb1, d3dfyb2
  • Chain 'C':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyc1, d3dfyc2
  • Chain 'D':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyd1, d3dfyd2
  • Chain 'E':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfye1, d3dfye2
  • Chain 'F':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyf1, d3dfyf2
  • Chain 'G':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyg1, d3dfyg2
  • Chain 'H':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyh1, d3dfyh2
  • Chain 'I':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyi1, d3dfyi2
  • Chain 'J':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyj1, d3dfyj2
  • Chain 'K':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyk1, d3dfyk2
  • Chain 'L':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyl1, d3dfyl2
  • Chain 'M':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfym1, d3dfym2
  • Chain 'N':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyn1, d3dfyn2
  • Chain 'O':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyo1, d3dfyo2
  • Chain 'P':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dfyp1, d3dfyp2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dfyA (A:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyA (A:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlvfrgkfiqdgprmrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dfyB (B:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyB (B:)
    rivnvklslkryeyekpesrnveveivlesgvkgygeaspsfrvngerveallaienavr
    emitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeiet
    dktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanm
    gytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvm
    rlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtg
    afefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dfyC (C:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyC (C:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlvfrgkfiqdgprmrvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dfyD (D:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyD (D:)
    rivnvklslkryeyekpesrnveveivlesgvkgygeaspsfrvngerveallaienavr
    emitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeiet
    dktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanm
    gytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvm
    rlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtg
    afefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3dfyE (E:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyE (E:)
    rivnvklslkryeyeesrnveveivlesgvkgygeaspsfrvngerveallaienavrem
    itgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeietdk
    tvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanmgy
    tqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvmrl
    vkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtgaf
    efhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3dfyF (F:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyF (F:)
    rivnvklslkryeyekpsesrnveveivlesgvkgygeaspsfrvngerveallaienav
    remitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeie
    tdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdan
    mgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdv
    mrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgt
    gafefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3dfyG (G:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyG (G:)
    rivnvklslkryeyeesrnveveivlesgvkgygeaspsfrvngerveallaienavrem
    itgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeietdk
    tvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanmgy
    tqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvmrl
    vkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtgaf
    efhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3dfyH (H:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyH (H:)
    rivnvklslkryeyekesrnveveivlesgvkgygeaspsfrvngerveallaienavre
    mitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeietd
    ktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanmg
    ytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvmr
    lvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtga
    fefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3dfyI (I:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyI (I:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlvfrgkfiqdgprmrvk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3dfyJ (J:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyJ (J:)
    rivnvklslkryeyekesrnveveivlesgvkgygeaspsfrvngerveallaienavre
    mitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeietd
    ktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanmg
    ytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvmr
    lvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtga
    fefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3dfyK (K:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyK (K:)
    rivnvklslkryeyeesrnveveivlesgvkgygeaspsfrvngerveallaienavrem
    itgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeietdk
    tvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanmgy
    tqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvmrl
    vkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtgaf
    efhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3dfyL (L:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyL (L:)
    rivnvklslkryeyesesrnveveivlesgvkgygeaspsfrvngerveallaienavre
    mitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeietd
    ktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanmg
    ytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvmr
    lvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtga
    fefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3dfyM (M:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyM (M:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlvfrgkfiqdgprmrvk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3dfyN (N:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyN (N:)
    rivnvklslkryeyeksesrnveveivlesgvkgygeaspsfrvngerveallaienavr
    emitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeiet
    dktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanm
    gytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvm
    rlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtg
    afefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3dfyO (O:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyO (O:)
    rivnvklslkryeyesesrnveveivlesgvkgygeaspsfrvngerveallaienavre
    mitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeietd
    ktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanmg
    ytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvmr
    lvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtga
    fefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3dfyP (P:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfyP (P:)
    rivnvklslkryeyekpesrnveveivlesgvkgygeaspsfrvngerveallaienavr
    emitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeiet
    dktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanm
    gytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvm
    rlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsvhfalgtg
    afefhdldshlmlkeevfrgkfiqdgprmrvk