PDB entry 3dfx

View 3dfx on RCSB PDB site
Description: Opposite GATA DNA binding
Class: Transcription/DNA
Keywords: Activator, DNA-binding, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc, Zinc-finger, Transcription-DNA COMPLEX
Deposited on 2008-06-12, released 2008-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trans-acting T-cell-specific transcription factor GATA-3
    Species: Mus musculus [TaxId:10090]
    Gene: Gata3, Gata-3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dfxa_
  • Chain 'B':
    Compound: Trans-acting T-cell-specific transcription factor GATA-3
    Species: Mus musculus [TaxId:10090]
    Gene: Gata3, Gata-3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dfxb_
  • Chain 'X':
    Compound: DNA (5'-d(*dtp*dtp*dgp*dap*dtp*dap*dap*dap*dtp*dcp*dap*dgp*dap*dgp*dap*dtp*dap*dap*dcp*dc)-3')
  • Chain 'Y':
    Compound: DNA (5'-d(*dap*dap*dgp*dgp*dtp*dtp*dap*dtp*dcp*dtp*dcp*dtp*dgp*dap*dtp*dtp*dtp*dap*dtp*dc)-3')
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3dfxA (A:)
saarragtscancqtttttlwrrnangdpvcnacglyyklhninrpltmkkegiqtrnrk
mss

    Sequence, based on observed residues (ATOM records): (download) 
    >3dfxA (A:)
saarragtscancqtttttlwrrnangdpvcnacglyyklhninrpltmkkegiqtrn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3dfxB (B:)
saarragtscancqtttttlwrrnangdpvcnacglyyklhninrpltmkkegiqtrnrk
mss

    Sequence, based on observed residues (ATOM records): (download) 
    >3dfxB (B:)
saarragtscancqtttttlwrrnangdpvcnacglyyklhninrpltmkkegiqtrn

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.