PDB entry 3dfr

View 3dfr on RCSB PDB site
Description: crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. I. general features and binding of methotrexate
Class: oxidoreductase
Keywords: oxido-reductase, oxidoreductase
Deposited on 1982-06-25, released 1982-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Lactobacillus casei [TaxId:1582]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00381 (0-161)
    • conflict (7)
    • conflict (9)
    • conflict (89)
  Domains in SCOPe 2.07: d3dfra_
• Heterogens: NDP, MTX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3dfrA (A:)
  taflwaqnrngligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
  vlthqedyqaqgavvvhdvaavfayakqhldqelviaggaqiftafkddvdtllvtrlag
  sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka