PDB entry 3dfr

View 3dfr on RCSB PDB site
Description: crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate
Deposited on 1982-06-25, released 1982-10-21
The last revision prior to the SCOP 1.57 freeze date was dated 1984-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.152
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d3dfr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dfr_ (-)
    taflwaqnrngligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
    vlthqedyqaqgavvvhdvaavfayakqhldqelviaggaqiftafkddvdtllvtrlag
    sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka