PDB entry 3dfq

View 3dfq on RCSB PDB site
Description: D33S mutant fructose-1,6-bisphosphate aldolase from rabbit muscle
Class: lyase
Keywords: aldolase, mutant, Acetylation, Glycolysis, Lyase, Phosphoprotein, Schiff base
Deposited on 2008-06-12, released 2009-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.15
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered (32)
    Domains in SCOPe 2.06: d3dfqa_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered (32)
    Domains in SCOPe 2.06: d3dfqb_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered (32)
    Domains in SCOPe 2.06: d3dfqc_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-End)
      • engineered (32)
    Domains in SCOPe 2.06: d3dfqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dfqA (A:)
    phshpaltpeqkkelsdiahrivapgkgilaasestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfqA (A:)
    phshpaltpeqkkelsdiahrivapgkgilaasestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpssnhay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dfqB (B:)
    phshpaltpeqkkelsdiahrivapgkgilaasestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfqB (B:)
    phshpaltpeqkkelsdiahrivapgkgilaasestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpssnhay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dfqC (C:)
    phshpaltpeqkkelsdiahrivapgkgilaasestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfqC (C:)
    phshpaltpeqkkelsdiahrivapgkgilaasestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqasnhay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dfqD (D:)
    phshpaltpeqkkelsdiahrivapgkgilaasestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dfqD (D:)
    phshpaltpeqkkelsdiahrivapgkgilaasestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    h