PDB entry 3der

View 3der on RCSB PDB site
Description: Crystal structure of dipeptide epimerase from Thermotoga maritima complexed with L-Ala-L-Lys dipeptide
Class: isomerase
Keywords: dipeptide epimerase, Thermotoga maritima, enzymatic function, Isomerase
Deposited on 2008-06-10, released 2008-11-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.231
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dera1, d3dera2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3derb1, d3derb2
  • Chain 'C':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3derc1, d3derc2
  • Chain 'D':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3derd1, d3derd2
  • Heterogens: MG, ALA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3derA (A:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3derA (A:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3derB (B:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3derB (B:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3derC (C:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3derC (C:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3derD (D:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3derD (D:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk