PDB entry 3deq

View 3deq on RCSB PDB site
Description: Crystal structure of dipeptide epimerase from Thermotoga maritima complexed with L-Ala-L-Leu dipeptide
Class: isomerase
Keywords: dipeptide epimerase, Thermotoga maritima, enzymatic function, Isomerase
Deposited on 2008-06-10, released 2008-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.246
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3deqa1, d3deqa2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3deqb1, d3deqb2
  • Chain 'C':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3deqc1, d3deqc2
  • Chain 'D':
    Compound: Muconate cycloisomerase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3deqd1, d3deqd2
  • Heterogens: MG, ALA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3deqA (A:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3deqA (A:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3deqB (B:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3deqB (B:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3deqC (C:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3deqC (C:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3deqD (D:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3deqD (D:)
    rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
    llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
    ggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrg
    akyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaade
    sartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginq
    svhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk