PDB entry 3deo

View 3deo on RCSB PDB site
Description: Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43
Class: protein transport, membrane protein
Keywords: Chloroplast SRP system, Signal recognition particle, signal sequence, ankyrin repeat, chromodomain, type I turn, substrate protein recognition, L18 region, LHCP, ANK repeat, Chloroplast, Coiled coil, Plastid, Ribonucleoprotein, PROTEIN TRANSPORT, MEMBRANE PROTEIN
Deposited on 2008-06-10, released 2008-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.171
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle 43 kDa protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CAO, At2g47450, T30B22.25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3deoa1, d3deoa2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3deoA (A:)
    evnkiigsrtagegameyliewkdghspswvpssyiaadvvseyetpwwtaarkadeqal
    sqlledrdvdavdengrtallfvaglgsdkcvrllaeagadldhrdmrggltalhmaagy
    vrpevvealvelgadievedergltalelareilkttpkgnpmqfgrriglekvinvleg
    qvf