PDB entry 3deg

View 3deg on RCSB PDB site
Description: Complex of elongating Escherichia coli 70S ribosome and EF4(LepA)-GMPPNP
Class: ribosome
Keywords: ribosome, translation, LepA, EF4, GTP-binding, Membrane, Nucleotide-binding, Antibiotic resistance, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, tRNA-binding, Methylation
Deposited on 2008-06-10, released 2008-08-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: EM
Resolution: 10.9 Å
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: A/L-tRNA
  Species: Escherichia coli [TaxId:562]
  
• Chain 'B':
  Compound: P-tRNA
  Species: Escherichia coli [TaxId:562]
  
• Chain 'C':
  Compound: GTP-binding protein lepA
  Species: Escherichia coli [TaxId:83333]
  Gene: lepA, b2569, JW2553
  Database cross-references and differences (RAF-indexed):
  • PDB 3DEG (0-544)
  • Uniprot P60785 (0-544)
• Chain 'D':
  Compound: 30S ribosomal protein S12
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • PDB 3DEG (0-122)
  • Uniprot P0A7S3 (0-122)
  Domains in SCOPe 2.04: d3degd1
• Chain 'E':
  Compound: 30S RNA helix 8
  Species: Escherichia coli [TaxId:562]
  
• Chain 'F':
  Compound: 30S RNA helix 14
  Species: Escherichia coli [TaxId:562]
  
• Chain 'G':
  Compound: 50S RNA helix 42-44
  Species: Escherichia coli [TaxId:562]
  
• Chain 'H':
  Compound: 50S ribosomal protein L11
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • PDB 3DEG (0-140)
  • Uniprot P0A7J7 (0-140)
  Domains in SCOPe 2.04: d3degh1, d3degh2
• Chain 'I':
  Compound: 50S RNA helix 95
  Species: Escherichia coli [TaxId:562]
  
• Chain 'J':
  Compound: 50S RNA helix 71
  Species: Escherichia coli [TaxId:562]
  
• Chain 'K':
  Compound: 50S RNA helix 92
  Species: Escherichia coli [TaxId:562]
  

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3degD (D:)
  atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
  evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
  pka
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3degH (H:)
  akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
  yadrsftfvtktppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgad
  ieamtrsiegtarsmglvved
  

  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.