PDB entry 3deg

View 3deg on RCSB PDB site
Description: Complex of elongating Escherichia coli 70S ribosome and EF4(LepA)-GMPPNP
Class: ribosome
Keywords: ribosome, translation, LepA, EF4, GTP-binding, Membrane, Nucleotide-binding, Antibiotic resistance, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, tRNA-binding, Methylation
Deposited on 2008-06-10, released 2008-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: EM
Resolution: 10.9 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A/L-tRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'B':
    Compound: P-tRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'C':
    Compound: GTP-binding protein lepA
    Species: Escherichia coli [TaxId:83333]
    Gene: lepA, b2569, JW2553
    Database cross-references and differences (RAF-indexed):
    • PDB 3DEG (0-544)
    • Uniprot P60785 (0-544)
  • Chain 'D':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DEG (0-122)
    • Uniprot P0A7S3 (0-122)
    Domains in SCOPe 2.08: d3degd1
  • Chain 'E':
    Compound: 30S RNA helix 8
    Species: Escherichia coli [TaxId:562]
  • Chain 'F':
    Compound: 30S RNA helix 14
    Species: Escherichia coli [TaxId:562]
  • Chain 'G':
    Compound: 50S RNA helix 42-44
    Species: Escherichia coli [TaxId:562]
  • Chain 'H':
    Compound: 50S ribosomal protein L11
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DEG (0-140)
    • Uniprot P0A7J7 (0-140)
    Domains in SCOPe 2.08: d3degh1, d3degh2
  • Chain 'I':
    Compound: 50S RNA helix 95
    Species: Escherichia coli [TaxId:562]
  • Chain 'J':
    Compound: 50S RNA helix 71
    Species: Escherichia coli [TaxId:562]
  • Chain 'K':
    Compound: 50S RNA helix 92
    Species: Escherichia coli [TaxId:562]

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3degD (D:)
    atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
    evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
    pka
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3degH (H:)
    akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
    yadrsftfvtktppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgad
    ieamtrsiegtarsmglvved
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.