PDB entry 3deg
View 3deg on RCSB PDB site
Description: Complex of elongating Escherichia coli 70S ribosome and EF4(LepA)-GMPPNP
Class: ribosome
Keywords: ribosome, translation, LepA, EF4, GTP-binding, Membrane, Nucleotide-binding, Antibiotic resistance, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, tRNA-binding, Methylation
Deposited on
2008-06-10, released
2008-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-11, with a file datestamp of
2019-12-06.
Experiment type: EM
Resolution: 10.9 Å
R-factor: N/A
AEROSPACI score: -0.11
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: A/L-tRNA
Species: Escherichia coli [TaxId:562]
- Chain 'B':
Compound: P-tRNA
Species: Escherichia coli [TaxId:562]
- Chain 'C':
Compound: GTP-binding protein lepA
Species: Escherichia coli [TaxId:83333]
Gene: lepA, b2569, JW2553
Database cross-references and differences (RAF-indexed):
- PDB 3DEG (0-544)
- Uniprot P60785 (0-544)
- Chain 'D':
Compound: 30S ribosomal protein S12
Species: Escherichia coli [TaxId:83333]
Database cross-references and differences (RAF-indexed):
- PDB 3DEG (0-122)
- Uniprot P0A7S3 (0-122)
Domains in SCOPe 2.08: d3degd1 - Chain 'E':
Compound: 30S RNA helix 8
Species: Escherichia coli [TaxId:562]
- Chain 'F':
Compound: 30S RNA helix 14
Species: Escherichia coli [TaxId:562]
- Chain 'G':
Compound: 50S RNA helix 42-44
Species: Escherichia coli [TaxId:562]
- Chain 'H':
Compound: 50S ribosomal protein L11
Species: Escherichia coli [TaxId:83333]
Database cross-references and differences (RAF-indexed):
- PDB 3DEG (0-140)
- Uniprot P0A7J7 (0-140)
Domains in SCOPe 2.08: d3degh1, d3degh2 - Chain 'I':
Compound: 50S RNA helix 95
Species: Escherichia coli [TaxId:562]
- Chain 'J':
Compound: 50S RNA helix 71
Species: Escherichia coli [TaxId:562]
- Chain 'K':
Compound: 50S RNA helix 92
Species: Escherichia coli [TaxId:562]
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3degD (D:)
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>3degH (H:)
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtktppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgad
ieamtrsiegtarsmglvved
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.