PDB entry 3de9

View 3de9 on RCSB PDB site
Description: Crystal Structure of a Trimeric Cytochrome cb562 Assembly Induced by Nickel Coordination
Class: metal binding protein
Keywords: Ni-stabilized trimeric superstructure, Electron transport, Heme, Iron, Metal-binding, Periplasm, Transport, METAL BINDING PROTEIN
Deposited on 2008-06-08, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.222
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3de9a_
  • Heterogens: NI, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3de9A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemhd
    frhgfdilvgqihdalhlanegkvkeaqaaaeqlkttcnachqkyr