PDB entry 3ddc

View 3ddc on RCSB PDB site
Description: Crystal Structure of NORE1A in Complex with RAS
Class: hydrolase/apoptosis
Keywords: Oncogene, Tumorsuppressor, Ubiquitin Fold, RAS effector, RAP1, H-RAS, RASSF1, RASSF5, RAPL, NORE1, GMPPNP, Adaptor, Apoptosis, Microtubules, HYDROLASE-APOPTOSIS COMPLEX, Disease mutation, Golgi apparatus, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Palmitate, Prenylation, Proto-oncogene, Anti-oncogene, Cell cycle, Metal-binding, Microtubule, Phorbol-ester binding, Zinc-finger
Deposited on 2008-06-05, released 2008-07-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (29-30)
    Domains in SCOPe 2.02: d3ddca_
  • Chain 'B':
    Compound: Ras association domain-containing family protein 5
    Species: Mus musculus [TaxId:10090]
    Gene: Rassf5, Nore1, Rapl
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EBH1 (5-162)
      • engineered mutation (90)
      • engineered mutation (107)
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ddcA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvekydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'B':
    No sequence available.