PDB entry 3dd1

View 3dd1 on RCSB PDB site
Description: Crystal structure of glycogen phophorylase complexed with an anthranilimide based inhibitor GSK254
Class: transferase
Keywords: Glycogen Phosphorylase HLGP, Diabetes, Allosteric enzyme, Carbohydrate metabolism, Disease mutation, Glycogen metabolism, Glycogen storage disease, Glycosyltransferase, Nucleotide-binding, Phosphoprotein, Pyridoxal phosphate, Transferase
Deposited on 2008-06-04, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.169
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Gene: PYGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dd1a_
  • Chain 'B':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Gene: PYGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dd1b_
  • Heterogens: NBG, PLP, CFF, 25D, MES, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dd1A (A:)
    ggakpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalaht
    vrdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgld
    ieeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqvee
    addwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntv
    ntmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyf
    vvaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiek
    lpwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalf
    pkdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdk
    fqnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvk
    qenklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklf
    vprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvip
    atdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddv
    aaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadye
    ayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsn
    esnkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dd1A (A:)
    qisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtq
    qhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpwek
    srpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapnd
    gdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgst
    rgagtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtv
    lpealerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskri
    nmahlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpgl
    aeliaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinp
    ssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmi
    iklitsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnm
    kfmlngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelk
    lvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawnt
    mvlkniaasgkfssdrtikeyaqniwnveps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dd1B (B:)
    ggakpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalaht
    vrdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgld
    ieeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqvee
    addwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntv
    ntmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyf
    vvaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiek
    lpwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalf
    pkdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdk
    fqnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvk
    qenklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklf
    vprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvip
    atdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddv
    aaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadye
    ayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsn
    esnkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dd1B (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
    iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstgtv
    fdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpeale
    rwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlc
    ivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliae
    kigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdv
    qvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklits
    vadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlng
    altigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqi
    dngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkni
    aasgkfssdrtikeyaqniwnveps