PDB entry 3dcr

View 3dcr on RCSB PDB site
Description: x-ray structure of hiv-1 protease and hydrated form of ketomethylene isostere inhibitor
Deposited on 2008-06-04, released 2008-08-19
The last revision was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemical analogue HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DCR (0-98)
  • Chain 'B':
    Compound: Chemical analogue HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DCR (0-98)
  • Heterogens: KVS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3dcrA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3dcrB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf