PDB entry 3dcq

View 3dcq on RCSB PDB site
Description: LECB (PA-LII) in complex with the synthetic ligand 2G0
Class: sugar binding protein
Keywords: lectin, carbohydrate, sugar binding protein
Deposited on 2008-06-04, released 2009-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, PA3361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dcqa_
  • Chain 'B':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, PA3361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dcqb_
  • Chain 'C':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, PA3361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dcqc_
  • Chain 'D':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, PA3361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dcqd_
  • Heterogens: CA, 2G0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dcqA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dcqB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dcqC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dcqD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg