PDB entry 3dcq
View 3dcq on RCSB PDB site
Description: LECB (PA-LII) in complex with the synthetic ligand 2G0
Class: sugar binding protein
Keywords: lectin, carbohydrate, sugar binding protein
Deposited on
2008-06-04, released
2009-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fucose-binding lectin PA-IIL
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: lecB, PA3361
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3dcqa_ - Chain 'B':
Compound: Fucose-binding lectin PA-IIL
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: lecB, PA3361
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3dcqb_ - Chain 'C':
Compound: Fucose-binding lectin PA-IIL
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: lecB, PA3361
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3dcqc_ - Chain 'D':
Compound: Fucose-binding lectin PA-IIL
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: lecB, PA3361
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3dcqd_ - Heterogens: CA, 2G0, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3dcqA (A:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3dcqB (B:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3dcqC (C:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3dcqD (D:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg