PDB entry 3dck

View 3dck on RCSB PDB site
Description: x-ray structure of d25n chemical analogue of hiv-1 protease complexed with ketomethylene isostere inhibitor
Deposited on 2008-06-03, released 2008-08-19
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemical analogue HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DCK (0-98)
  • Chain 'B':
    Compound: Chemical analogue HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DCK (0-98)
  • Heterogens: KVI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3dckA (A:)
pqitlwkrplvtiriggqlkeallntgaddtvieelnlpgcwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3dckB (B:)
pqitlwkrplvtiriggqlkeallntgaddtvieelnlpgcwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf