PDB entry 3dc0

View 3dc0 on RCSB PDB site
Description: Crystal structure of native alpha-amylase from Bacillus sp. KR-8104
Class: Hydrolase
Keywords: crystal structure, native alpha-amylase, Hydrolase
Deposited on 2008-06-03, released 2008-06-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.196
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Bacillus sp. KR8104 [TaxId:535911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3GQD0 (0-421)
      • conflict (39)
      • conflict (46)
    Domains in SCOPe 2.04: d3dc0a1, d3dc0a2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dc0A (A:)
    psiksgtilhawnwsfntlknnmkdihdagytaiqtspinqvkegnkgdksmgnwywlyq
    ptsyqignrylgseeefkemcaaaeeygvkvivdavinhttsdyaaisneiksisnwthg
    ntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrydaakhiel
    pddgnygsqfwpnitntsaefqygeilqdsasrdaayanymnvtasnyghsirsalknrn
    lsvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgstplf
    fsrpdgggngvrfpgktqigdrgsalfedqaivavntfhnvmagqpeelsnpngnnqifm
    nqrgskgvvlanagsssvsinastklpdgsydnkagtgsfqvrdgkltgtinarsvavly
    pd