PDB entry 3dbj

View 3dbj on RCSB PDB site
Description: Allophycocyanin from Thermosynechococcus vulcanus
Class: photosynthesis
Keywords: phycobilisome, light harvesting, photosynthesis, energy transfer, cyanobacteria
Deposited on 2008-06-01, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.212
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allophycocyanin
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbja_
  • Chain 'B':
    Compound: allophycocyanin
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbjb_
  • Chain 'C':
    Compound: allophycocyanin
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbjc_
  • Chain 'D':
    Compound: allophycocyanin
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbjd_
  • Chain 'E':
    Compound: allophycocyanin
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbje_
  • Chain 'F':
    Compound: allophycocyanin
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbjf_
  • Chain 'G':
    Compound: allophycocyanin
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbjg_
  • Chain 'H':
    Compound: allophycocyanin
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbjh_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dbjA (A:)
    msvvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfq
    krpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslg
    tpipavaegiramknvacsllsaedaaeagsyfdfvigamq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dbjA (A:)
    svvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfqk
    rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslgt
    pipavaegiramknvacsllsaedaaeagsyfdfvigamq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dbjB (B:)
    mqdaitavinasdvqgkyldtaameklkayfatgelrvraasvisanaanivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpiaatvqaiqamkevtaslvgadagkemgiyfdyicsgls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dbjC (C:)
    msvvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfq
    krpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslg
    tpipavaegiramknvacsllsaedaaeagsyfdfvigamq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dbjC (C:)
    svvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfqk
    rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslgt
    pipavaegiramknvacsllsaedaaeagsyfdfvigamq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dbjD (D:)
    mqdaitavinasdvqgkyldtaameklkayfatgelrvraasvisanaanivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpiaatvqaiqamkevtaslvgadagkemgiyfdyicsgls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3dbjE (E:)
    msvvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfq
    krpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslg
    tpipavaegiramknvacsllsaedaaeagsyfdfvigamq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dbjE (E:)
    svvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfqk
    rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslgt
    pipavaegiramknvacsllsaedaaeagsyfdfvigamq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dbjF (F:)
    mqdaitavinasdvqgkyldtaameklkayfatgelrvraasvisanaanivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpiaatvqaiqamkevtaslvgadagkemgiyfdyicsgls
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3dbjG (G:)
    msvvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfq
    krpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslg
    tpipavaegiramknvacsllsaedaaeagsyfdfvigamq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dbjG (G:)
    svvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfqk
    rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslgt
    pipavaegiramknvacsllsaedaaeagsyfdfvigamq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dbjH (H:)
    mqdaitavinasdvqgkyldtaameklkayfatgelrvraasvisanaanivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpiaatvqaiqamkevtaslvgadagkemgiyfdyicsgls