PDB entry 3db7

View 3db7 on RCSB PDB site
Description: Crystal structure of a putative calcium-regulated periplasmic protein (bt0923) from bacteroides thetaiotaomicron at 1.40 A resolution
Class: Ca-BINDING PROTEIN
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, ca-binding protein
Deposited on 2008-05-30, released 2008-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative calcium-regulated periplasmic protein
  Species: Bacteroides thetaiotaomicron [TaxId:818]
  Gene: NP_809836.1, BT_0923
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8A994 (1-126)
    • leader sequence (0)
  Domains in SCOPe 2.08: d3db7a1, d3db7a2
• Heterogens: CA, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3db7A (A:)
  gadddkpiqvtqmpqlaqqfikqhfsdskvalakmesdflyksyeviftngnkvefdkkg
  nweevdckhtsvpvaiipaaiqkyvttnypdakvlkierdkkdyevklsnrtelkfdlkf
  nlididn