PDB entry 3dax

View 3dax on RCSB PDB site
Description: Crystal structure of human CYP7A1
Class: oxidoreductase
Keywords: cytochrome p450, cholesterol, cholesterol 7-alpha hydroxylase, Structural Genomics, Structural Genomics Consortium, SGC, Cholesterol metabolism, Endoplasmic reticulum, Heme, Iron, Lipid metabolism, Membrane, Metal-binding, Microsome, Monooxygenase, NADP, Oxidoreductase, Polymorphism, Steroid metabolism
Deposited on 2008-05-30, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 7A1
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP7A1, CYP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22680 (7-485)
      • expression tag (6)
      • expression tag (486-487)
    Domains in SCOPe 2.07: d3daxa1, d3daxa2, d3daxa3
  • Chain 'B':
    Compound: Cytochrome P450 7A1
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP7A1, CYP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22680 (7-End)
      • expression tag (6)
    Domains in SCOPe 2.07: d3daxb1, d3daxb2
  • Heterogens: HEM, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3daxA (A:)
    makktssrrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvh
    fitnplsyhkvlchgkyfdwkkfhfatsakafghrsidpmdgnttenindtfiktlqgha
    lnsltesmmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdt
    qkahilnnldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiseli
    slrmflndtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkr
    tlenagqkvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledg
    synirkddiialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympf
    gsgaticpgrlfaiheikqflilmlsyfeleliegqakcppldqsraglgilpplndief
    kykfkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3daxA (A:)
    srrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpl
    syhkvlchgkyfdwkkfhfatsakafghrsidpmdgnttenindtfiktlqghalnslte
    smmenlqrimrawvtegmysfcyrvmfeagyltifgrdltrrdtqkahilnnldnfkqfd
    kvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmflndtlstfddl
    ekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagqkvslegnpi
    clsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkddiialypql
    mhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgaticpgrlfaihe
    ikqflilmlsyfeleliegqakcppldqsraglgilpplndiefkykfkhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3daxB (B:)
    makktssrrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvh
    fitnplsyhkvlchgkyfdwkkfhfatsakafghrsidpmdgnttenindtfiktlqgha
    lnsltesmmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdt
    qkahilnnldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiseli
    slrmflndtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkr
    tlenagqkvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledg
    synirkddiialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympf
    gsgaticpgrlfaiheikqflilmlsyfeleliegqakcppldqsraglgilpplndief
    kykfkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3daxB (B:)
    srrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpl
    syhkvlchgkyfdwkkfhfatsakafghrsidpmdgnttenindtfiktlqghalnslte
    smmenlqrimraawvtegmysfcyrvmfeagyltifgrdltrrdtqkahilnnldnfkqf
    dkvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmflndtlstfdd
    lekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagqkvslegnp
    iclsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkddiialypq
    lmhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgaticpgrlfaih
    eikqflilmlsyfeleliegqakcppldqsraglgilpplndiefkykfk