PDB entry 3dat

View 3dat on RCSB PDB site
Description: Crystal structure of the ternary MTX NADPH complex of Bacillus anthracis dihydrofolate reductase
Class: oxidoreductase
Keywords: dual-site inhibition, oxidoreductase, pseudo-Rossmann fold, adenine nucleotide binding domain
Deposited on 2008-05-30, released 2009-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis str. [TaxId:260799]
    Gene: dfrA, BAS2083, BA_2237, GBAA2237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3data_
  • Heterogens: MTX, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3datA (A:)
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

    Sequence, based on observed residues (ATOM records): (download) 
    >3datA (A:)
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekq