PDB entry 3dao

View 3dao on RCSB PDB site
Description: crystal structure of a putative phosphate (eubrec_1417) from eubacterium rectale at 1.80 a resolution
Class: hydrolase
Keywords: putative phosphate, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, hydrolase
Deposited on 2008-05-29, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Phosphate
    Species: Eubacterium rectale
    Gene: RER070207001050
    Database cross-references and differences (RAF-indexed):
    • PDB 3DAO (Start-282)
    Domains in SCOPe 2.07: d3daoa1, d3daoa2
  • Chain 'B':
    Compound: Putative Phosphate
    Species: Eubacterium rectale
    Gene: RER070207001050
    Database cross-references and differences (RAF-indexed):
    • PDB 3DAO (Start-282)
    Domains in SCOPe 2.07: d3daob1, d3daob2
  • Heterogens: 1PE, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3daoA (A:)
    mgsdkihhhhhhenlyfqgmikliatdidgtlvkdgsllidpeymsvidrlidkgiifvv
    csgrqfssefklfapikhkllyitdggtvvrtpkeilktypmdediwkgmcrmvrdelpa
    cdyfaatpdfcfaedggspifhllrdsygfemrevdditrldrndiikftvfhpdkceel
    ctpvfipawnkkahlaaagkewvdcnakgvskwtalsylidrfdllpdevccfgdnlndi
    emlqnagisyavsnarqeviaaakhtcapywengvlsvlksfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3daoA (A:)
    gmikliatdidgtlvkdgsllidpeymsvidrlidkgiifvvcsgrqfssefklfapikh
    kllyitdggtvvrtpkeilktypmdediwkgmcrmvrdelpacdyfaatpdfcfaedggs
    pifhllrdsygfemrevdditrldrndiikftvfhpdkceelctpvfipawnkkahlaaa
    gkewvdcnakgvskwtalsylidrfdllpdevccfgdnlndiemlqnagisyavsnarqe
    viaaakhtcapywengvlsvlksfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3daoB (B:)
    mgsdkihhhhhhenlyfqgmikliatdidgtlvkdgsllidpeymsvidrlidkgiifvv
    csgrqfssefklfapikhkllyitdggtvvrtpkeilktypmdediwkgmcrmvrdelpa
    cdyfaatpdfcfaedggspifhllrdsygfemrevdditrldrndiikftvfhpdkceel
    ctpvfipawnkkahlaaagkewvdcnakgvskwtalsylidrfdllpdevccfgdnlndi
    emlqnagisyavsnarqeviaaakhtcapywengvlsvlksfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3daoB (B:)
    hhhenlyfqgmikliatdidgtlvkdgsllidpeymsvidrlidkgiifvvcsgrqfsse
    fklfapikhkllyitdggtvvrtpkeilktypmdediwkgmcrmvrdelpacdyfaatpd
    fcfaedggspifhllrdsygfemrevdditrldrndiikftvfhpdkceelctpvfipaw
    nkkahlaaagkewvdcnakgvskwtalsylidrfdllpdevccfgdnlndiemlqnagis
    yavsnarqeviaaakhtcapywengvlsvlksfl