PDB entry 3daj

View 3daj on RCSB PDB site
Description: Crystal structure of Aurora A complexed with an inhibitor discovered through site-directed dynamic tethering
Class: transferase
Keywords: Protein-small molecule inhibitor complex, Kinase, TRANSFERASE
Deposited on 2008-05-29, released 2008-07-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.253
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine kinase 6
    Species: Mus musculus [TaxId:10090]
    Gene: Aurka, Stk6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C3H8
      • engineered (53)
      • engineered (107)
    Domains in SCOPe 2.04: d3daja_
  • Heterogens: FXG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dajA (A:)
    gplgskrqwtledfdigrplgkgkfgnvylarerqskfilalkvlfktqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklsrfdeqrtatyite
    lanalsychskrvihrdikpenlllgsngelkiadfgwsvhapssrrdtlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgmppfeahtyqetyrrisrveftfpdfvtegardl
    isrllkhnasqrltlaevlehpwikansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dajA (A:)
    qwtledfdigrplgkgkfgnvylarerqskfilalkvlfktqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklsrfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsngelkiadfgwstldylppemihdekvdlwslgvlcyefl
    vgmppfeahtyqetyrrisrveftfpdfvtegardlisrllkhnasqrltlaevlehpwi
    kanss